PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_012209
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family NAC
Protein Properties Length: 243aa    MW: 27531 Da    PI: 6.5148
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_012209genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM140.41.1e-4351352127
          NAM   2 ppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 
                  +pGfrF Pt+eelv++yL ++++g++ ++l++vi+ vdiy++eP++Lp+     +++++++w+fF++ ++++a+g r+nr+t+sgyWkatg+   v+s
  DCAR_012209   5 QPGFRFYPTEEELVSFYLSHRLQGHNqTDLDRVIPVVDIYDLEPSQLPNysgeLCREDKEQWFFFVPMHEREARGGRTNRTTASGYWKATGSPSYVYS 102
                  69*********************9985677778***************646654445777************************************** PP

          NAM  95 kkgelvglkktLvfykgrapkgektdWvmheyr 127
                  ++++++g+kkt+v+y+g+ap g+kt+W m+ey+
  DCAR_012209 103 SQNKVIGVKKTMVYYRGKAPLGRKTRWKMNEYK 135
                  ********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-454164IPR003441NAC domain
PROSITE profilePS5100545.2174166IPR003441NAC domain
PfamPF023653.4E-236135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MATFQPGFRF YPTEEELVSF YLSHRLQGHN QTDLDRVIPV VDIYDLEPSQ LPNYSGELCR  60
EDKEQWFFFV PMHEREARGG RTNRTTASGY WKATGSPSYV YSSQNKVIGV KKTMVYYRGK  120
APLGRKTRWK MNEYKAIEEQ VIAGASTSCA APRLRHEMSV CRVYVISGTF RAFDRRPLGT  180
AIMEPVDEPQ DGQENIVTRT SSSAEYIYRE TDIGNTMIID NAGVSCSEPM IIHHAAPFSG  240
ED*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-30316419166NAC domain-containing protein 19
3swm_B1e-30316419166NAC domain-containing protein 19
3swm_C1e-30316419166NAC domain-containing protein 19
3swm_D1e-30316419166NAC domain-containing protein 19
3swp_A1e-30316419166NAC domain-containing protein 19
3swp_B1e-30316419166NAC domain-containing protein 19
3swp_C1e-30316419166NAC domain-containing protein 19
3swp_D1e-30316419166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015872891.13e-92PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR37e-80NAC90_ARATH; NAC domain-containing protein 90
TrEMBLQ9SXQ02e-90Q9SXQ0_TOBAC; NAC-domain protein
STRINGSolyc11g068620.1.17e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24942357
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.14e-81NAC domain containing protein 90